SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004490m|PACid:19677425 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004490m|PACid:19677425
Domain Number 1 Region: 81-124
Classification Level Classification E-value
Superfamily F-box domain 0.000000379
Family F-box domain 0.0076
Further Details:      
 
Domain Number 2 Region: 200-382
Classification Level Classification E-value
Superfamily RNI-like 0.00000126
Family 28-residue LRR 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004490m|PACid:19677425
Sequence length 496
Sequence
MTYGQIEQYFNSMEGPTAQQRIDCIVAFLISFLPPPLVPAPEVAGDDSDDESFSLTSSDS
ETSDAGADLASFHPAALSDGEDHISRLPDALLSNIISRLATQEAARTVVLSTRWHGVWAA
TPLLIDDAHLVGADGLNDIPIMRAVSRCVAAHPGPVSGVRVTRVSFYSHEYSLRRLVADL
ADKDIQDLILFNRPWPLNMPLPKDILRCASLERLYLGVWQFPKITSAHPPLFDKLRELGL
FHCILEILSIVMSYGSPSRLCIVSRSLQVAVDWKSTLHEVVLQDAPCLERLILQTMETRM
PIKIVGAPRLEVLGFLDLNLHELEIGGIPIKARMNMKDRATVPSLKILAVTVHFVRNQEA
KMLPTLLKCFPRLEALHVLAIPSESVSSDHDLEFWESLGSCERLESHLKTVMVHGCLVHN
NEIGFLQYIIREGKALKAVGVDPSPKNMVAIDLVLASFGEGASSDDIFHARVDGRFIFQN
AIDMTLDNPFCVDDPV
Download sequence
Identical sequences K3XRE8
Si004490m|PACid:19677425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]