SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004518m|PACid:19675050 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004518m|PACid:19675050
Domain Number 1 Region: 46-111
Classification Level Classification E-value
Superfamily F-box domain 0.000000000353
Family F-box domain 0.0076
Further Details:      
 
Domain Number 2 Region: 172-289,329-395
Classification Level Classification E-value
Superfamily RNI-like 0.0000000149
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si004518m|PACid:19675050
Sequence length 499
Sequence
GEDEDTDTALKFAYGSLSLPPPLAIPDAALAAAARAAWTGPPDDGVDRISSLPDGILRNV
VSRLPVKDAARTGALASRWRGLWRSMPLVFADANLLDGCIANPLWRPGLKDTLGVTNEVS
DILAAHPGPFRCVQITCCYLDMNREKIKSWLKLAADKGVQELAFINRPWPLNLPLPATLF
SCTSLTRLHIGAWKLPDTAKLPHGVAFPHLQELFLSLITMKDRDLAFLLDRSPVLEVLTI
IASQRDVSLCLVSHSLRCLQLGMSSLGHIAVADAPRLERLFLLRTRRIGGNKSSRIKIGN
APNLRLLGYWPPGQHELQIGNAIIEARTKVSPSTIIPSVQILALQVHFEVRNEVKTVPSI
LKCFPNVETLHIQSVKVDKPTGKVNLKFWLEACPVGCVKHVKKLVIHGFKGSKNEHAFIK
FIIGERAQALETMVIVMCLETFSSTNCLDAKMKPFLTVKCASKDIKKITSVLPTSPNPWS
FRMATDVSCRDPFDRASAV
Download sequence
Identical sequences K3XRH6
Si004518m|PACid:19675050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]