SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004597m|PACid:19677945 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004597m|PACid:19677945
Domain Number 1 Region: 60-130,186-311,355-373
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000772
Family Tricorn protease domain 2 0.042
Further Details:      
 
Weak hits

Sequence:  Si004597m|PACid:19677945
Domain Number - Region: 8-42
Classification Level Classification E-value
Superfamily F-box domain 0.0207
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si004597m|PACid:19677945
Sequence length 398
Sequence
MLQLQLQLQDLQDFPPVHDWSQLPADLLIRIFVDLDVLNLFSEARRLGHGPYCRNKSPCL
LYSSNDNDPNTATLCRLTNKKLYRVMLPDPPPLRSCFVVGSCHGLLTIADEQSKLHLVNP
LSRAQIALPPPLTIKNVRGCYTTDEVLDSYHLLKLDLVNHECDAQAEPDDLTLEQGCFYF
YLRVAMSADPSSGRCIVDARWTWIDVDQRCYSYNDFFYNDSNGLFYVVRGNGEVHTIDLN
GPSPVVKIILRPMAPCIDNNKYIAQAPWGGMLQVWRYDDIVEEGEGRAVQLEVYMVDLAE
QKLVEIKNLQEHVLFIGFNTPFFLLAEDYNMLTPDCIYLTNDYMDYIYSKKFGPRQVLVF
NMKDGSLTDLFPDSDSDFWLSWPLPIWITPYYSQDNKG
Download sequence
Identical sequences K3XRQ3
Si004597m|PACid:19677945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]