SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004620m|PACid:19676360 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004620m|PACid:19676360
Domain Number 1 Region: 18-93
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000314
Family F-box domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004620m|PACid:19676360
Sequence length 368
Sequence
MGLKTASKRKRKRDTPELFDEIVWEILIRLPVKSLVRFRSVSKAWRAIISDPSFETWSTA
TLVYGRHFPAGEFGTVSQMVHCDGLVLLSTNTKAYVFNPATRDAIALPESKRNALPLHDT
CLPIGLGMDASTGRYKVARAFYRPSDDDPTRMAAMGMEVFTIGGEDGSWRETLEDPPYLM
ASFWQAAAHCKGCLFYFIDKKNHQNPPQGLIRFNLQDETFGITPLIPDLLPQVEDDDIAL
SELDGELCACFFSKWLQRLMIFTTGDILDRSDDAHWRCRYVIDLPECHPMALHGSGGILM
RLGHCLFRYDLGAHGIQGKDDFHWMDRLKYVGLRCRGRAWKNLCFFNLSSYTESLVPLNA
KASSQALQ
Download sequence
Identical sequences K3XRS4
Si004620m|PACid:19676360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]