SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004711m|PACid:19675154 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si004711m|PACid:19675154
Domain Number - Region: 18-64
Classification Level Classification E-value
Superfamily F-box domain 0.00183
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004711m|PACid:19675154
Sequence length 409
Sequence
MEPRPEKRMKTEVESRQELPDDLVLEIIARCPTIADVIRCAVASKPIRRGILHAPFLRRL
RGFLTRNGNGRPPVRKLLLGLYHQIGDPHRQPPFAPASDGADLLPPSVAELAPAPDRGGG
GACEFGPYLPVASRRSLLVLRRRCRNGDRDHRVERHGLYPVELSVCNPTTGERRVLPPHD
VFDMSHALLDVDPIAPSSSFKLLVAALSENDPSTLYVQVFSSEGGEWGHPLACSMTSSRG
DGEVSCEFAGADDGRPRPVVLGDTVHWLCTTESGGRILSWRWRGGGEREASIVKLPRGYK
LGRPEKCLAVLPSAGDAAGPEALLSLIVLVRDEIEVWAREKGGAGSTRKWEWKLRHRIRE
ASISRPANLCDGWMIGAELSWFCEGSGTLFLWAGDETMGPLLLDLQSME
Download sequence
Identical sequences K3XS14
Si004711m|PACid:19675154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]