SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004763m|PACid:19678763 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si004763m|PACid:19678763
Domain Number - Region: 5-48
Classification Level Classification E-value
Superfamily F-box domain 0.000523
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si004763m|PACid:19678763
Sequence length 419
Sequence
MAQPTERSSLPDWTSLPKELLESIGKRLASGHDAASFRAACSLWRAAVPFAAFGPLLLLP
LDPDSDTVSFYSVPEKKVFSLTLPDVRGKVPCGSSCGWLALMDEAASVTLLNPFTGARVE
LPPADEHVAAAATSSERVSKVSGRWVLRSGNGSGNAPAANAVKLELKDMRGVFFHEIVLS
APPDAGGECVAMAVLASFTEIAICRVGVDSAWTLLDTKLEFSVASIVHCQGKFLAIDVTG
EISVLSINADAVANPTAAPLPSLSPPAGLCHRSYLESDGELHLVGAMVSMFHETQQFTYR
SMIYKCNLLDGAPEWSRVKDVGDLTLFVSKCFSESFSGTSVSKYKKNSIYFSEPLYGDPY
DFAHRFEIVDIAAGTSKVKTFHENMQGSEALGWIRPNLWERGLHIRASSWMFLAHGHKY
Download sequence
Identical sequences K3XS66
Si004763m|PACid:19678763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]