SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004842m|PACid:19676767 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si004842m|PACid:19676767
Domain Number - Region: 274-309
Classification Level Classification E-value
Superfamily F-box domain 0.000798
Family F-box domain 0.008
Further Details:      
 
Domain Number - Region: 390-490
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00824
Family Galactose oxidase, central domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004842m|PACid:19676767
Sequence length 495
Sequence
GKQCLACFQGEWLLMFDGGTNECCLVSLASLSRISLPPLLTPLENLYMCALSSPTLPDCT
IMFTTERTKDGGDDDDDDDEERYLVYYRPGDEEWWELLDETDGTYDAISNEIVGCQGTMY
VRTNMYTFITVNALLSSFIGASIERRGIPHPSTMRWGHNEHLVESDGDVFLLQFYTHGTT
QRSSTWTFIDWTPRDTYVWEKVESIGDRTIFVISSDCVVLSSASRAGIQPGRIHLLHGDC
YDGIRLYTIRLDDRTMSCSLLPRSFNSMSWVVPSSLPVELVEELVPRISFIDYLNVRQVC
QGWSLISRPTQYGRRYQIYPTLLSICSSSVGVFKLFDPIVEKEYTMKSSSLVPYTMARPE
FAGISFSSPPNSPNCIVCSIHKERASNPAYSNTIYVVVWRTGDKELTEKEIGAKQPYFLH
GEFYCPGTRGSLGIFNPNNMTWRVLDKPDPILVGDPMPGEHYCHLLEFRDDLIVIFRPHD
KGPIDLYKFDKSQMV
Download sequence
Identical sequences K3XSE3
Si004842m|PACid:19676767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]