SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004929m|PACid:19675516 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004929m|PACid:19675516
Domain Number 1 Region: 39-81
Classification Level Classification E-value
Superfamily F-box domain 0.0000000353
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004929m|PACid:19675516
Sequence length 221
Sequence
MDRPTLELWRDRGMDLQLLEDDTRSALSLPVSHHAALSVLPALDGADHISALPDALLRNI
VSRLPVNDAACTAALSWRWRGHSTPLILVDVHLTSSHVEAFPSLLARTSPLSVKGVRHLV
LVNRPWPLNVDLPATFFGMRTVAFPHLKELGLSCMGIENWDMDFVLAKSPVLSLRCVQII
EEGIELEIAVEDAPPLERLMCGHHQPATSCPGGSRLAMPRH
Download sequence
Identical sequences K3XSM9
Si004929m|PACid:19675516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]