SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004999m|PACid:19673467 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si004999m|PACid:19673467
Domain Number - Region: 47-86
Classification Level Classification E-value
Superfamily F-box domain 0.0371
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004999m|PACid:19673467
Sequence length 437
Sequence
MPCTPFSRQKRARRADPPTTPTAVPDWTSLTDDLVRRVGDCLLATDDIDCYLAFRAVCHD
WRRSATKDDHPSRRFHPSKWALLDRRDDVLTLVNVETGRFLRRRIPLLRDCFFVGATAGG
LLLLGESAYPYQARVLNPFTGSLAHFKAPVPVGRQAREVAVVMTSSTTMRVFVSTALGAI
MWADQDSDYFHKCDAPFPNPSDLLCMVPFAGNVYLTNRQGSVLSISTAVGGVAGQGQRRR
RSAETISSMAAATIIPASVEGGRSYYLVESGGELFLVTRPWYGVPGQLEVHRVDTMRKAL
EPVRSIGNRALFLSHVRCLSVDADKFRTVEAGCIYFVDQIVAGGSYFECSFMTTVRFPDG
VQQPALDLSPVQQGCFRPFSLTHAFANYCKFIIQYSELRRKMIDDDEDFSDDYGYSDEED
FSDDYESDDGGSSESDQ
Download sequence
Identical sequences K3XSU6
Si004999m|PACid:19673467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]