SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si005044m|PACid:19676679 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si005044m|PACid:19676679
Domain Number - Region: 12-45
Classification Level Classification E-value
Superfamily F-box domain 0.0203
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si005044m|PACid:19676679
Sequence length 452
Sequence
MASPPAPWAEGLAIDLLLLIIAGLCCQADRASFASVCQRWREAAKLAKPVRSQIPWLLLP
SPSSTPSIFSFFSGLRRRIRSLPADFRRERLCGSHPGGWVAVALGPFGGHLLANIFSGAR
VGLPHRLMQLPSPILRVTPVLIRAVMLSAAPTAAHCVAGALVCGASNVAFCCPGDSHWFA
YPEIDGLQDMVYYAGEEEEKRGFYVLEGLGDVQVLSFDIIQVKSAPTVMKYVVRAKSIKY
VMPEQAPDTMLSSLPASTCRTGYLVVSRAKLLKVLRYYSRDDQTGARRTLLFRVFEMQIS
SDHRASWMELDNLDGRVLFVGRGCSRAFEASQLHGFNGGSIYYLDDAEFDVMPCLQNEAE
YPSSDMGMYSMRGTTVRPSLDAPSANMRPATYGAKTYLTRFVNGDNGNQQSSVVEMTEDE
ARRSTGGEIIGTRWSILSEPQSKFSPPIWFCP
Download sequence
Identical sequences K3XSZ0
XP_004971875.1.39314 Si005044m|PACid:19676679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]