SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si005049m|PACid:19677698 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si005049m|PACid:19677698
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily F-box domain 0.00000000693
Family F-box domain 0.0033
Further Details:      
 
Weak hits

Sequence:  Si005049m|PACid:19677698
Domain Number - Region: 202-343
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00161
Family DPP6 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si005049m|PACid:19677698
Sequence length 423
Sequence
MEQAVAGRDWSQLPADLVVLVLGALEVPELLRSAAVCRSWRAAYKLDPRLDATPLFRGPC
LLYSSADRDADVATLRSLSESAAADHTTSTRRRHHVTLPAPSFRGRYVVGSSHGWLITAD
EQSELFLVNPVTRAQIALPPVKTMRSLNLRLARSSKALQGYFLHYMDVAAGCRNSHMYDL
REFYDPNEARFLLYRRVALSADPSSGNCIVLIIHCFQEQLSFARIGDAEWTWIHGEEHFC
HYQDLFYNDKDSLFYALRGTGEVHTIDFSGSSSPVVKIIFKKVVNYIDNYKYLVRAPRGD
LIQVWRDDDVVDNGEWVTKKLVVYKMDLVHQKVAEVKDLQGYALFLGFNTSFFLPVACSP
MLKANCIYHTDDNTEYIGGHKFSRRHIVAFSLDENVFAEFLPCDSRLNWPPPIWIRPSCE
WVG
Download sequence
Identical sequences K3XSZ4
Si005049m|PACid:19677698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]