SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si005187m|PACid:19678761 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si005187m|PACid:19678761
Domain Number 1 Region: 43-147
Classification Level Classification E-value
Superfamily F-box domain 7.33e-18
Family F-box domain 0.0026
Further Details:      
 
Domain Number 2 Region: 106-384
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000000615
Family Galactose oxidase, central domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si005187m|PACid:19678761
Sequence length 406
Sequence
MIGLMEDHSPWDYLSVDQIRTPAFNSGVVSEASNGGKEFSVSLDAVVPDDILERIFTFLP
IASMIRATAVCKRWYGIIYSSRFLWTHMMPQRPWYFMFTSNETAAGYAFDPILRKWYDLE
LPYIDKSSCFVSSSCGLVCFMDNDNRNSISVSNPITKNSKRLLEPPGETLPDYSTIAMKV
DRLSHKYSITVAKSKQIPEDFVRWEFSVYKYDSWSGTWVTSASEVFIGWRGGDDSVICDG
VLYCLIHSTGVLGNVNPRHGLIMYDLVGGPSKTSLVQTSIPVPCSLTCGRLVNLKEKLVL
VGGIAKHNRPDIIKGIGIWELHEKQWHEVTRMPHKFFQGFGEFDDVFACSGTDDLVYIQS
YGATALLVFDMMHKQWKWSVKCPVSKRFPLQLFTGFCFEPRLDITA
Download sequence
Identical sequences K3XTD1
XP_004969368.1.39314 Si005187m|PACid:19678761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]