SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si006057m|PACid:19703796 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si006057m|PACid:19703796
Domain Number 1 Region: 301-617
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.7e-40
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 58-168
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.52e-19
Family Flavin-binding PAS domain 0.0011
Further Details:      
 
Domain Number 3 Region: 214-277
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000262
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si006057m|PACid:19703796
Sequence length 631
Sequence
MEWDSESDGAGSVGAGEEEEQEKEEEEAEVGVSGGGGDGGAGGMFTFAIEGMLRASGPCG
LVVTDALEPDCPIIYVNRGFEDATGYRAEEVLGRNCRFLQCRGPFAQRRHPLVDAAMVSN
IRRCIDNGTEFRGDLLNFRKDGSPLMNRLHLTPIYGDDATITHYMGIQFFTNANVDLGPL
PGSITKEPVRSTRFAPDNSFRPISTGPGESNFCREYSSIFQLTDEVLCQSILSRLSPRDI
ASVSSVCRRMYHLTRNEDLWRMVCQNAWGSETTQALETVPAARRLGWGRLARELTTLEAV
AWRKLTVGGAVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNASNPEWRHINV
SAAPPGRWGHTLSCLNGSWLVVFGGCGRQGLLNDVFMLDLDAKQPTWREIPGVAPPVPRS
WHSSCTLDGTKLVVSGGCADSGVLLSDTYLLDVTMDRPVWREVPASWKPPSRLGHSMSVY
GGRKILMFGGLAKSGPLRLRSSDVYTMDLSEEEPCWRCLTGSGMPGAGNPAGAGPPPRLD
HVAVSLPGGRILIFGGSVAGLHSASQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVV
GGTKAIVLGGQTGEEWMLTEIHELSLASNTV
Download sequence
Identical sequences K3XVU9
XP_004966157.1.39314 Si006057m|PACid:19703796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]