SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si006063m|PACid:19704518 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si006063m|PACid:19704518
Domain Number 1 Region: 167-303,407-625
Classification Level Classification E-value
Superfamily RNI-like 2.98e-40
Family 28-residue LRR 0.021
Further Details:      
 
Domain Number 2 Region: 41-81
Classification Level Classification E-value
Superfamily F-box domain 0.0000017
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si006063m|PACid:19704518
Sequence length 628
Sequence
MSPFQGYRGDGALAGVRSRKRVFASAAAEPAVTAAPKRQKRREEPSLDALPDECLFEVLR
RVRGARARCASACVSRRWLALLAGIRASEAVLAPPAPAVPDLNQEYLGGEDDDEADLMDH
DGDARERTLEGKEATDARLTAAAVAGRLSAVSVRGSHPARGVTDAGVSALARGCPALRSL
SLWDVPQVTDAGLAEIAAECHALERLDVTGCPLVTDKALIAVAQGCPELKSLTIEACSGV
ANEGLKAIGRSCTKLQAVNIKNCAHVDDQGVSGLVCSATASLAKVRLQGLSITDASLAVI
GYYGKAITDLTLARLPAVGERGFWVMANAMGLQKLRCMTVTSCPGLTDLALASVAKFSPS
LKLVNLKKCSKVSDGCLKEFAESARVLENLQIEECNKVTLMGILAFLLNCSPKFKALSLV
KCIGIKDICSAPAQLPVCKSLRSLTIKDCPGFTDASLAMVGMICPQLENVNLSGLGAVTD
NGFLPLIKSSESGLVNVDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSRITDASLFAI
SESCSQLAELDLSNCMVSDYGVAVLAAAKQLKLRILSLSGCMKVTQKSVPFLGSMSSSLE
GLNLQFNFIGNHNIASLEKQLWRCDILA
Download sequence
Identical sequences K3XVV5
Si006063m|PACid:19704518 XP_004965933.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]