SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si006070m|PACid:19703797 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si006070m|PACid:19703797
Domain Number 1 Region: 296-511
Classification Level Classification E-value
Superfamily Kelch motif 1.1e-34
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 58-162
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-20
Family Flavin-binding PAS domain 0.0026
Further Details:      
 
Domain Number 3 Region: 453-624
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-19
Family Kelch motif 0.022
Further Details:      
 
Domain Number 4 Region: 208-271
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000209
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si006070m|PACid:19703797
Sequence length 625
Sequence
MEWDSESDGAGSVGAGEEEEQEKEEEEAEVGVSGGGGDGGAGGMFTFAIEGMLRASGPCG
LVVTDALEPDCPIIYVNRGFEDATGYRAEEVLGRNWGPFAQRRHPLVDAAMVSNIRRCID
NGTEFRGDLLNFRKDGSPLMNRLHLTPIYGDDATITHYMGIQFFTNANVDLGPLPGSITK
EPVRSTRFAPDNSFRPISTGPGESNFCREYSSIFQLTDEVLCQSILSRLSPRDIASVSSV
CRRMYHLTRNEDLWRMVCQNAWGSETTQALETVPAARRLGWGRLARELTTLEAVAWRKLT
VGGAVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNASNPEWRHINVSAAPPG
RWGHTLSCLNGSWLVVFGGCGRQGLLNDVFMLDLDAKQPTWREIPGVAPPVPRSWHSSCT
LDGTKLVVSGGCADSGVLLSDTYLLDVTMDRPVWREVPASWKPPSRLGHSMSVYGGRKIL
MFGGLAKSGPLRLRSSDVYTMDLSEEEPCWRCLTGSGMPGAGNPAGAGPPPRLDHVAVSL
PGGRILIFGGSVAGLHSASQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTKAI
VLGGQTGEEWMLTEIHELSLASNTV
Download sequence
Identical sequences K3XVW2
XP_004966158.1.39314 Si006070m|PACid:19703797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]