SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si006179m|PACid:19703113 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si006179m|PACid:19703113
Domain Number 1 Region: 174-496
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-48
Family WD40-repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 72-162
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000576
Family F-box domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si006179m|PACid:19703113
Sequence length 551
Sequence
MAFDCNKGRGVSSPDNCSSICPEGTLIQANPLSHYWKAKGWKSRNKLGNQKSSYESIPRD
SNPKKDDEVRGEATASTCGLRCFTDLPAALVCEVLARLDAKELGIVSCVSTLLHTLATDH
HGWKKLYCERWGLPNLPATLNGLLVPGGPLDGKSWKTFFVEREFRSKSFMGKFNVDVFRG
HNEDVRAVFLLASANLIFSGGRDSVVRMWNMEEGLLIDTSRPLGGTIRAIAADTRLLVTG
GTNAYIQCWRAVEGNDHLFHISGNGTDQNSEFRLWGHEGPLTCLALDSLRIYSGSWDMTV
RVWDRTRMECLQKLMHADWVWDLAPHGNTIASTAGRDVYVWDIRNSELTSLISNAHVGNA
YSLARTHLMDVLFTGGEDGAIRLFNISDVSDDEDSKPLATWVPHSGPVHSLAFEYPWLVS
ASSDGRIALIDSRKLLTPKKSSKGPFSVKSFDVSTIEPPQRMLHGFRCDLFSIAIGADRI
VCAGEDGAVRVWNFSEALEIERRAQALRSLRQENRMRRRKAQAEMNANGRRPDQCSIAMK
KNQLKGDKSVT
Download sequence
Identical sequences K3XW71
XP_004965208.2.39314 Si006179m|PACid:19703113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]