SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si006232m|PACid:19703721 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si006232m|PACid:19703721
Domain Number 1 Region: 130-316
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000392
Family 28-residue LRR 0.071
Further Details:      
 
Weak hits

Sequence:  Si006232m|PACid:19703721
Domain Number - Region: 25-61
Classification Level Classification E-value
Superfamily F-box domain 0.000687
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si006232m|PACid:19703721
Sequence length 526
Sequence
MAPPLLGASCSKKRRAGGLAEEGQGEVAAAEEEEDRISALPEDLRLRILALLPLNSAIRT
RALLASLERRGRRRLDRFALTLHFGDYGSPKPHRYLGNKDIHRCLDYAAACDVEDLHIDI
ADHFLSMGSMLSFPSGFSRLVRLSLLRVGTVSFGYSFGSDAFPALEIIHLHYAHSVELNR
LLSASPRLRTLDLRYCEFIDDQGAIDVSPARGHLWSLTIAECNYITDIHAGRASGLPSFR
LSSALLPTYDIPSTAPLEDLYICLRGHNYNPIKQWIKELPHLTNLTVLTICSIALRSLQL
LMFAMASTNLAHIYMFLKTCQCPQLERLFVQLPTSSRDTSVGNSSKVARKDEPAGVFDED
EPDEELSEEDETDGGLSEEDETEKELLEEERVQEYMLKERLYYEDVYYEEDTLDENVPQE
EQSEEDVPGYGLNNLMTAKMMKFKGHYFEMRLVSFLLRKAPVLKKLLLVAPKGHIKALGK
GTFNISHFIEPKLLRSRKASPDAQVILSETDFAENQPVHSDVFASF
Download sequence
Identical sequences K3XWC4
Si006232m|PACid:19703721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]