SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si006668m|PACid:19704263 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si006668m|PACid:19704263
Domain Number 1 Region: 124-202
Classification Level Classification E-value
Superfamily F-box domain 3.14e-20
Family F-box domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si006668m|PACid:19704263
Sequence length 379
Sequence
MADVQGDEAGLEDDPPPEEGLVDPDEGVEADVGGGGDEDEEDVDGLASFLESEILSGSSA
EDPIDQQEEGDAVKNKRKQESGSDGDGGNGSGSGSGSSSDGEQNKRARREEKRRQAKGKF
VAVAPQIDTGMFSSIPPELFLQIFKFLSSEDLISCALVCRFMNAAASDETLWRRLYCMRW
GLASNAKFRERAWKNLYIQRDREDMVEFVRNTPTEFREYYIQMQAAKRSQAPLPSEVNDD
KVILDKTVADQVSTWKSSRGLTDESVKGHSCSGNTCSYTQIGDAYICEKTGRVHVCDDAC
REFVLDQSSGLLLCTISGHCFERWLCPDDEWDADDTDQQQGGVADEPEPFMGSGRFARAI
MLGYNCSDEKELEHALRFC
Download sequence
Identical sequences K3XXL0
Si006668m|PACid:19704263 XP_004966398.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]