SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si006719m|PACid:19704640 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si006719m|PACid:19704640
Domain Number 1 Region: 5-49
Classification Level Classification E-value
Superfamily F-box domain 0.000000288
Family F-box domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si006719m|PACid:19704640
Sequence length 366
Sequence
MMAAAESLSWSDLPPELLGLVLKHLPSLADRVRLRAVCQPWRSNARLQSLPPPLPWLTLP
DGTFLSIPDGEIIQMAVADGACCCGSIDNWLFLMQNDGGCSLTNPFSKATLDLPKLATVW
RRDWLNANEGFNPLFYKLVVPSPLDSSPESLVAVLILDSANSSTVCICQPPVATDISRGR
HMEPSRCLFDVAFFNGKLYGVAFGDKLVIFEIGYDLGCKPKISATECIINSRDDDLWDLP
QSLSNEKAYMWREYLVECCGGLLKADLSTNPGHWRRVNKLGGQALFVGRHCSKSFAAKEY
NGIQEDCIYFMCDYPWPDSAADPLRDSGVYNLRNGTITPLLSQTATVPQHHGGHWRPTWF
FPADSI
Download sequence
Identical sequences K3XXR1
Si006719m|PACid:19704640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]