SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si006850m|PACid:19704691 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si006850m|PACid:19704691
Domain Number - Region: 77-223
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000889
Family Tricorn protease domain 2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si006850m|PACid:19704691
Sequence length 335
Sequence
MAGAGWSSLPADLLKEVSGRLSSDADHLHIHQYSLRLPRGDGRRLELGAPPAGLPYCCGA
SRGWLALVDDGQSPTRLVLWEPLSSTEISLQCLSPLTRIFISDDPLTSSDWIAIAAQIKG
EIGRKTLFWRPGDATWTMMNERGTCEIDTVAFHGGKAYYIDIQQNIVICDLNTGSDPSPR
CAPIFFACSVVNKLCRCPRLHPVCGVHLAVCNGELLLVVLYYWGSHPSPAEAYKPVWTPN
QRLELHERVRDLGDHSLFVGRGDTFALSAKEFPVIKRNCIYYAGIACNKPYWVSVFHLES
DVVEEIPYMEKLKEGRTNRTPYAWFRPRKPFLKQS
Download sequence
Identical sequences K3XY42
Si006850m|PACid:19704691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]