SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si007255m|PACid:19705889 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si007255m|PACid:19705889
Domain Number 1 Region: 27-84
Classification Level Classification E-value
Superfamily F-box domain 0.00000000654
Family F-box domain 0.0047
Further Details:      
 
Domain Number 2 Region: 113-208
Classification Level Classification E-value
Superfamily L domain-like 0.00000289
Family Internalin LRR domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si007255m|PACid:19705889
Sequence length 217
Sequence
MRLRSGRHLVSPLTVPQGGHHHRQRLRGSDDRIDSLPKDLLLQVLVRLKHAERAACVGAV
CRSWHGLWIELPELTFGFVKPRMLEAVLAKVKRGAQVSLLLRAATRLVPEKLMFHVWNHL
TLEDDPIELPCFDRTSSLALEVMGFHLLPPLSGEFTALKSLSLSDCRGIDIGALLPLCPS
LRVLNMYHLVEVGTMMVHSASLEELNLETKKYWLHPN
Download sequence
Identical sequences K3XZ96
Si007255m|PACid:19705889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]