SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si007838m|PACid:19705526 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si007838m|PACid:19705526
Domain Number 1 Region: 7-44
Classification Level Classification E-value
Superfamily F-box domain 0.000000101
Family F-box domain 0.0029
Further Details:      
 
Weak hits

Sequence:  Si007838m|PACid:19705526
Domain Number - Region: 59-133,176-250
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00112
Family Tricorn protease domain 2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si007838m|PACid:19705526
Sequence length 278
Sequence
MATLYPDWAGLPQEMVATVMRALDIPDLFRAGTVCSSWYAAYSDVRRVRIPITDAAPCLL
YSARDNGDASDATLYSPSSGGKAFKVRLPDPPLGSRALVGSSHGWLAAADEASNLHLVNP
LTGAQVALPPVMALYHVESSVDEQGSLEYSVQEGEDPDDPVRYPAQKLRLFLYYKVAMSC
SPSKVRDRIVLLLHRPDGQISFAHIGDDKWTQITDQTLKWDSGYRDALYNKNDGLFCVLS
FDGSMLTSDPSDPSSPVAKDIVLAADRWFFSFHSAKRV
Download sequence
Identical sequences K3Y0X6
Si007838m|PACid:19705526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]