SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si007990m|PACid:19705761 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si007990m|PACid:19705761
Domain Number - Region: 5-43
Classification Level Classification E-value
Superfamily F-box domain 0.00458
Family F-box domain 0.0078
Further Details:      
 
Domain Number - Region: 320-393
Classification Level Classification E-value
Superfamily Macro domain-like 0.00571
Family Macro domain 0.011
Further Details:      
 
Domain Number - Region: 192-311
Classification Level Classification E-value
Superfamily YWTD domain 0.011
Family YWTD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si007990m|PACid:19705761
Sequence length 427
Sequence
MPAGAPIPPWADLEPSLVSTIADCCALKDYASCRAVCAAWRSALPPPLSRPLAVLPADDA
ASLPVSLAACPLYVRRWSRLLLHRPGGTVGAAARCRCVGASRDGWVALVAGDAAAPAGPM
LFNPFTGEEIPLDESLYQPAHGQLAPKIVFAPNPTRRDFTAASLIRPDMVAVQRAADGCS
YSEDTGPLLDGVILVDIAYGDNGKVYCLAWDGEVHVLHLTRRHRVFRQMPPMEVGPLLKL
PIGADAFPPPYDVISEYTDGKNLVLCEGGLYQVWRRSSGSGSVTVDAPPGGAARWIHIFE
GDVFVLRYDPGNWPGSCWVVADAKDLRGNAVFVGMNDAAVVRGEGVSANSVYHWDGPRGG
DGDYEAVAVVYNVATRASVRWPAVSTGGVSCPVWYFLPAAGVSQRVGAETASVDAMSGEE
AISLEHN
Download sequence
Identical sequences K3Y1C6
Si007990m|PACid:19705761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]