SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008001m|PACid:19703215 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008001m|PACid:19703215
Domain Number 1 Region: 162-386
Classification Level Classification E-value
Superfamily RNI-like 0.0000000471
Family 28-residue LRR 0.046
Further Details:      
 
Domain Number 2 Region: 28-68
Classification Level Classification E-value
Superfamily F-box domain 0.0000000536
Family F-box domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si008001m|PACid:19703215
Sequence length 431
Sequence
MHKQYTNAEPLPWEANLQRRKLEFQHLDLPEDMLCKILSQLPLKEVIRTSDLSSKWRYVR
TINPKLRFDGMTMCSHRSIYGSKQCTQEFIQSVNAALQQHNGMFVEDFELKFGLHSELVI
HLDDWVRFVTASQTKNLAFDLVPAEFRGRHDRKFDLHLVRATTKDLNVLSSCSSLEWLSM
VRCHLDDELKVDLPLPRLKYLCVADSMITGIKVNAMNIETFVYKGWRYPIETRSLDLKDA
HLHFFDWISIEDTLTILPTVLSHMPTMLENASKFSQLKYLVLELTVSDKDAGNILSLASY
LRAAPLVEKFELHVTLLIILFLPQLLQFNVVIYPHLDLEPLRSFPQCPRIYLKDLYISGF
VACTGQLEFLLHTVENAPGLEILTLDPAPKFDKNVGTEHGQRTDLFSQDVREISIRYLSG
RISPTAKLCIL
Download sequence
Identical sequences K3Y1D6
Si008001m|PACid:19703215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]