SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008045m|PACid:19704856 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008045m|PACid:19704856
Domain Number 1 Region: 9-50
Classification Level Classification E-value
Superfamily F-box domain 0.00000419
Family F-box domain 0.0063
Further Details:      
 
Weak hits

Sequence:  Si008045m|PACid:19704856
Domain Number - Region: 119-216
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0102
Family DPP6 N-terminal domain-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si008045m|PACid:19704856
Sequence length 382
Sequence
MKRLRIATAGGSGWSTLPGDLLEQISSRLSTDADRLHVRQVCAHWRACTSPLAALRPWIV
ARAGPLPTSGHPAYSAWLPRRLRQQRMVGVRAAPAGLPHCRGASRGWLALVDDIRSPTRL
VLWDPVSGSEVPLPCLSRVTQVFLSGDPLGSPDWIAVASQRVSTLGTKLFFWRPGDAAWS
SLFEQPTAGVPSVVFHGGRMFYMDLRQLIAAYDLNLGAPNRRPASAGMSYFGPKVDKLCR
CERLVHLVREVLMVSCDGELLLVVLRVSSACSSFAEVYKLDWTPKGTPKIGERVTDLGEY
SLFLGLSESFALSAKEFPAVRRNHIYCVNPYHKLSDWAFVFDLGSDTLKGIPYPEELRDD
GAKWWPYYWLCLRSPLTKKQQN
Download sequence
Identical sequences K3Y1I0
Si008045m|PACid:19704856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]