SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008196m|PACid:19703917 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008196m|PACid:19703917
Domain Number 1 Region: 73-121
Classification Level Classification E-value
Superfamily F-box domain 0.0000000144
Family F-box domain 0.0075
Further Details:      
 
Domain Number 2 Region: 208-344
Classification Level Classification E-value
Superfamily RNI-like 0.00000302
Family 28-residue LRR 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si008196m|PACid:19703917
Sequence length 549
Sequence
MDQQFLMGMNMREMGDISNPQLQAIMEQLGVDCPQLVGLGVDMALQYLYDATPPPPVSRR
APLASAAVSAPTGDDIDCLSRLPDGILKNVVSRLPAKDAARTAALASRWRGIWRSAPLAV
VDAHILPDGFAAVRMAPGGDDPSSMLVVAAASRVLAAHPGPFRCVQLTCTHMASHRDEAA
RWLKLLADKGVQELAFINRPWPLDLPLPTEFFGCAASLTRLHLGVWRFPSTAGLPRSARF
PHLKELVLSLIIVGDRDLQFLVDRSPVLEILTIISSQIDVRLRLISRTLRCVQLGMSALA
DVNVVDAPRLERLLLWMTMNHDKGSRIKIGHAPNLRMLGHWQLADHELEIGNTVIKVGTK
VSPSTIVPSVKILALEVQSEVRNDVKMVPCFLKCFPNVEILHVYSQNADHTTSKLNLKFW
QEAGHIECVQSHVKKFVFEEFRGNRSELSLLKFIAEKAQILEKMVVMVVSECFSSVDDVN
AKLKPLTSAKWASENCKLSVFMSPVSERGSPTWHFRIGSDFSWSDPFDLMAADAEHRGNA
VLHYFSSTL
Download sequence
Identical sequences K3Y1X7
Si008196m|PACid:19703917 XP_012700705.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]