SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008235m|PACid:19705673 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008235m|PACid:19705673
Domain Number 1 Region: 25-78
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000262
Family F-box domain 0.0049
Further Details:      
 
Domain Number 2 Region: 145-345
Classification Level Classification E-value
Superfamily RNI-like 0.00000000204
Family 28-residue LRR 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si008235m|PACid:19705673
Sequence length 464
Sequence
QEMAIDTAAASGGEKRQRVDEQGDRCGSVGADAIPADRISALPDELQQRILTHLPLKDAV
RTGAVARGWRDLWKGRWAHRASPRPRRRIDRFSLIVDTCKFKSSQIRRFIEYAAECRVED
LHVETRKITAADKLNFHLPLASLLLARLSLRRTSISNMYYKGAQPFHALEVILLHSVSIA
QATFKRMMALCPSLLTLDLRGCACEPLFFWGEAMVWPAKLRSITVAACSGTIRLDLVRVP
SLRSFRFSCGFLDIPFFLAGEAFNKGLPNDLSALTVLTICNNALPVVSSSYDDGATAQLP
KLSNLHGLRELHLLMLKMEDANLADIYVFLKTIQCHNLERLFVQLPGFVYEPMEGSQSLD
VAPEEPPEDGLDNLAMVKVMGVSKHPHFNWRCAEVQLVSFLLRKAKSLQKLLIVSPNVTP
RDVPGVQEADLLFLKEALANGKIILSESDDAATQPYHSEVFIKL
Download sequence
Identical sequences K3Y216
Si008235m|PACid:19705673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]