SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008236m|PACid:19704952 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008236m|PACid:19704952
Domain Number 1 Region: 9-50
Classification Level Classification E-value
Superfamily F-box domain 0.00000471
Family F-box domain 0.0063
Further Details:      
 
Weak hits

Sequence:  Si008236m|PACid:19704952
Domain Number - Region: 117-220,254-271
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0051
Family DPP6 N-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si008236m|PACid:19704952
Sequence length 410
Sequence
MKRLRIATAGGSGWSTLPGDLLEQISSRLSTDADRLHVRQVCAHWRACTSPLAALRPWIV
ARAGPLPTSGHPAYSAWLPRRLRQQRMVGVRAAPAGLPHCRGASRGWLALVDDIRSPTRL
VLWDPVSGSEVPLPCLSRVTQVFLSGDPLGSPDWIAVASQRVSTLGTKLFFWRPGDAAWS
SLFEQPTAGVPSVVFHGGRMFYMDLRQLIAAYDLNLGAPNRRPASAGMSYFGPKVDKLCR
CERLVHLVREVLMVSCDGELLLVVLRGATGSRGGRQPPSSPSQVSSACSSFAEVYKLDWT
PKGTPKIGERVTDLGEYSLFLGLSESFALSAKEFPAVRRNHIYCVAHHWIYYIYYQNPYH
KLSDWAFVFDLGSDTLKGIPYPEELRDDGAKWWPYYWLCLRSPLTKKQQN
Download sequence
Identical sequences K3Y217
Si008236m|PACid:19704952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]