SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008278m|PACid:19704642 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008278m|PACid:19704642
Domain Number 1 Region: 43-96
Classification Level Classification E-value
Superfamily F-box domain 0.0000000693
Family F-box domain 0.0077
Further Details:      
 
Weak hits

Sequence:  Si008278m|PACid:19704642
Domain Number - Region: 156-310
Classification Level Classification E-value
Superfamily RNI-like 0.000361
Family Rna1p (RanGAP1), N-terminal domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si008278m|PACid:19704642
Sequence length 424
Sequence
MEAPERQDSEEKSSQSPRELQPPPATAADAPHSEPTPRAQEPQPVSTGEEGDDVDRISSV
PDAVLGEIISLLPTRDAARTQSLASRWRHLWLSAPLNLDHTSLPADEQVQVDPRCSPRPR
PPLLRASVPPPRPRSNDSIWWTWPKRFTFPSSGSLDFEFLKISDCTMNSIIAGCPVLECL
LINACTGFSPIRINSPSPRSIAMSCMELIIEDAPSLQRLVHLKPCSALRVSVISAPKLET
LGCLCDHGFESNLLFGTTNLHSDCFTTVASSVKILAICIFNLSLDMVIDLMRCFPCLEKL
YIQSCLAKDKNLWRGKHRNLRRCLDIRLKTIVLKNYQGMMSQVNFATFFVLNAKMLEFMR
FEVGADNDNEVFIAEQHRKLQLEKKASRYAQFYFTNSGGCHGLGLSHVKPVTDLSITDPF
ECRC
Download sequence
Identical sequences K3Y258
Si008278m|PACid:19704642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]