SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008490m|PACid:19703713 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008490m|PACid:19703713
Domain Number 1 Region: 4-73
Classification Level Classification E-value
Superfamily F-box domain 0.0000294
Family F-box domain 0.0088
Further Details:      
 
Weak hits

Sequence:  Si008490m|PACid:19703713
Domain Number - Region: 154-279
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00298
Family WD40-repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si008490m|PACid:19703713
Sequence length 428
Sequence
EWRDWANLTSELVEDIAGRLLSDDVSEYYRFRAVCRPWRDHTADLRARGALDRRFRPRNW
VVLTISPDAGPRRRVINMATAASLSVNLPALTTHCHLGAVDGLLVLFHRITKAICLLDPL
NNAVTEFPAISISSIMATVPPVMAYHFSMFFRSPNSLNGHSINGACLDESTSPPTLVLCM
RDDQSCIIVAKPGDPHWTLVNQGKLYHSETMGRVMFHSLLSQGGRCYVASLEGSIFLVEL
GPLPQLVKIIDQHQHATRDAILYIRIISYLVGGSNGRMLLVRYWRNVEHFGGRGAYNQTQ
LFTVGGVTGRIEVSEVDIAGRTLIPVRSLGHYAAFVGMTHCMLVSTKTFPSIVADAIYLG
YSYQLSRKFSIYYLKTRRAEPPHEFVLDENQRVVPCARPCNLDQYLVCYVDRKHRLSGPC
INHLAPCP
Download sequence
Identical sequences K3Y2R0
Si008490m|PACid:19703713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]