SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008518m|PACid:19702978 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si008518m|PACid:19702978
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily F-box domain 0.000425
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si008518m|PACid:19702978
Sequence length 262
Sequence
MMTTARSSPWPDIQPELLGLVLRRLPSLADHVRLRALCRPWRYNARVEPLPPTTYMDGEI
HHMPLLDDASCHGSMDNWLFFVHNDDGCTLMNPFSKAALQLPNLTTTWHHEMKYAYTRDS
LFYKLCLSIGTGHLSWFNMLADIAFFNGKMYGLGSGKHTDTQLSVFEMNYGLDGKLKISG
VECITRDLVKECLSNLGGQQALFVGKHCSKSLPAGGCTGIQEDCIYFMNGIITPLLSEGV
AVPQHRGGLWRPTWLFPADDAM
Download sequence
Identical sequences K3Y2T7
Si008518m|PACid:19702978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]