SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008655m|PACid:19705225 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008655m|PACid:19705225
Domain Number 1 Region: 72-114
Classification Level Classification E-value
Superfamily F-box domain 0.00000000262
Family F-box domain 0.008
Further Details:      
 
Weak hits

Sequence:  Si008655m|PACid:19705225
Domain Number - Region: 203-344,380-399
Classification Level Classification E-value
Superfamily RNI-like 0.000471
Family 28-residue LRR 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si008655m|PACid:19705225
Sequence length 545
Sequence
MEHQPLMGVSMRKMKAKLQSDLKRDGVDVPDALGMGTAMMLMFLYPAIPNPPVSPAAPLA
SAVAARAPGDGVDRISRLPDPILKNIVSRLPAKDAARTATLASRWRGLWCSVPLALVDAH
IVPRGVRTDRMAPGGDDITSMVGVLVASRVLEAHPGPFRCAHLTRGHMASHQPKIERWLK
LLAAKGVQELVFINRPWPLDFPLPASLFGCAASLTRLHLGAWRFPSTARLPRATRFQNLQ
ELVLSLIIIEDRDLQFLIDKSPVLEILTVITSQTGNRVRLVSRSLRCVQMTMSALADITV
VDAPRLERLFLWMITCSPRSDMRSRIKIGHAPKLRMLGHWQPELELEIGNTIIKVGTKVS
PSTMVPSVKILALELQFEVHSEVKMVPSFLRCFPNVETLHVFSLNAPSGTPDLKFWLEVG
CIDCVQKHVKKFVFQEFRGKRSELAFLKFIAERAQVLEKMVVMVSSACFSSADGVTAKLK
PLISAKWVSKDCKLIVFKSQSTDGASPAWVFRIASDFSCSDPFDLLTAYAELSNDASVLH
PSSTL
Download sequence
Identical sequences K3Y370
Si008655m|PACid:19705225 XP_004966980.2.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]