SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008657m|PACid:19704018 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008657m|PACid:19704018
Domain Number 1 Region: 146-284
Classification Level Classification E-value
Superfamily RNI-like 0.0000000184
Family Cyclin A/CDK2-associated p19, Skp2 0.051
Further Details:      
 
Weak hits

Sequence:  Si008657m|PACid:19704018
Domain Number - Region: 70-112
Classification Level Classification E-value
Superfamily F-box domain 0.00172
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si008657m|PACid:19704018
Sequence length 484
Sequence
MYFPTDLSSSSTYPKIHPLPPPPLLLPQPHPNYSLSPICATSTPSNRNKATTNGNNELQP
PTREWEGEEGIDRISGLLDGVLGDIISLLPTKNGARTQILASRWRDLWPYAPLNLNHNSL
PVNEEVQAGLISHIIANHNGPARRISLPVLHLHHRRATLNTWLQSPTLKNLQDLEFEATG
LVHIPRLRPLLSEYVFKFSHTLRSATISECQVRDMIEVRHFPNLKQLGLESVMISDYAFH
NLMVGCPILESLLLKRCYGFYSIRINSTSLKSIGLSTNTTKVTIVIEDAPLLERFLKLEL
FIGKCIHVTVISAPKVETLGSISDCDSDDQLVFDTTVIQKLDVVSFTRVVCSVKVLAISI
HNLGPGIVINLMRCFPCMEKLYIQISNVQRSNNICPHMHRDLIRCLDTSLTTVVLKNYRG
TKFEGLACKGNKKLIAKQRRLLHIKERASRGALFCFTSCRCHSYPPHIKHVDDLSKGDPF
KCTC
Download sequence
Identical sequences K3Y372
Si008657m|PACid:19704018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]