SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008714m|PACid:19705347 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008714m|PACid:19705347
Domain Number 1 Region: 79-337
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000106
Family Cyclin A/CDK2-associated p19, Skp2 0.083
Further Details:      
 
Weak hits

Sequence:  Si008714m|PACid:19705347
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily F-box domain 0.00883
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si008714m|PACid:19705347
Sequence length 382
Sequence
DVQCIIFSKLELKEAVRSSVLSSKWANKGMIHSKLRFDGSKMYGKYMSGKYRTLKFIDNV
NRVLKLHHGKVVETLEIKQIQLSFVSFKLPSQFSGFPKLKRLDLYLLHVNRKDLQDMLSG
CSNLEWLSIARCDLEDELIVDRPLSHLLYLRVAHCKMTKIELHAAKLRTFIHNGTQLPVH
TIQAQELKDAEIAVTNFTTFEHALNVLPKMLARVQNLTLQVPLRLKSSSLLEKSSKFPQL
RHLKLLLRHSPEDLDNILSLASFLRAAPLIEELEIHFDITGRGNAEVGRLRNLPKCPYKH
LRNICISGFIGTQGQAELLVHAVENAPALEVVTIDTANKSGNSLFQDVDRRGAYIARSCL
EGKISPKTKLHINNCSCEVTIR
Download sequence
Identical sequences K3Y3C9
Si008714m|PACid:19705347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]