SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008792m|PACid:19705688 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si008792m|PACid:19705688
Domain Number - Region: 117-319
Classification Level Classification E-value
Superfamily RNI-like 0.000916
Family Cyclin A/CDK2-associated p19, Skp2 0.035
Further Details:      
 
Domain Number - Region: 51-87
Classification Level Classification E-value
Superfamily F-box domain 0.049
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si008792m|PACid:19705688
Sequence length 432
Sequence
MAAASDAKKRRPDAYESQDPKQIIGPSKDQIQHPALLPPTTSESEETQIQESPPTRLLEG
EEGINLINCLPESIVGEIISLLPTKDARLISKIIDNHKSSVRHFAVSVLLLHRRRQTLNR
WLLFSALNNLQELEFDASGLIYTEIRRPLLSHHVFCFSSTVCITTISECQMPDPVESFHF
PQLAQLGLESVMISNDSLDNLITGCPILESLLLKQCYGLMACIRINSSSLKSIGFSPRCT
KLVIEDAPMLERLLQLENSEVEIVMVISAPKLETKLDVVNYPKVGCCSVKILAISVCNLS
LDMVISLMRYFPCMEKLYIELSDFPKGNNVWPREHHHGLIRCLDINLKKVVLKNYRGTES
HSIAYNDKKQLIAMQQRLLELKKKASRGAHFYFTASSCHHWLPHIKHVHDLAKGDPFRCT
FGMPLNSLISSK
Download sequence
Identical sequences K3Y3K5
Si008792m|PACid:19705688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]