SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si008828m|PACid:19704108 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si008828m|PACid:19704108
Domain Number 1 Region: 117-375
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-19
Family Kelch motif 0.014
Further Details:      
 
Weak hits

Sequence:  Si008828m|PACid:19704108
Domain Number - Region: 55-100
Classification Level Classification E-value
Superfamily F-box domain 0.00283
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si008828m|PACid:19704108
Sequence length 427
Sequence
MAAPAAAKRPCWPPAAAAEPNKRHRTAAAAPMDDAAAAAEADRSRAHAQQRQPWERHPQQ
QPLLPGLPDHLAHLCLAPLPPRLLHTVCRPWRRLLYSPSFPPFLSLYAVLDGGADASGAG
VSFAAYDAVAGRWDELPAPPMPSPPPRLWHPSFLSRRLPLQSVAAAGRLVLVAGSTRSLS
PALPRPVVFDPSAPSPRWRLGPQFPFAPRRWCAAGSARGRVFVAGGVGAGYDANDARSGA
VWDPASPAAAWEPLPPMRDCRFSRDAAEAVCSGGKVCMVSLRGRGAKEGAVFDLAAGRWE
DMPPGMLAGWKGSAAAVAPAGGAETIFVVDEERGALSAYDWGGDRWRTVAESERLKGAAE
MAAGGGRVCVAAEGGEKVIVVDVTPPKPPRWAGSGPSTAPPRMWEVAAPPGKRVVALHVL
PRMPRAE
Download sequence
Identical sequences K3Y3P1
Si008828m|PACid:19704108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]