SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si009271m|PACid:19693820 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si009271m|PACid:19693820
Domain Number 1 Region: 443-487
Classification Level Classification E-value
Superfamily F-box domain 0.000000000144
Family F-box domain 0.0084
Further Details:      
 
Domain Number 2 Region: 8-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000000667
Family F-box domain 0.0081
Further Details:      
 
Weak hits

Sequence:  Si009271m|PACid:19693820
Domain Number - Region: 813-866
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.0146
Family Nickel-iron hydrogenase, small subunit 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si009271m|PACid:19693820
Sequence length 968
Sequence
MASSKKRSKSASAACLPDEIVELILLRLPASATIRFHAVCRAWALLLSSPGFKDAYAAEA
SARRRRASEFVLLAPSPASPNGATAVYSCRPGGAGAEPLFTIDRLRPGFLIASSKPCNGL
VLLTDTSCGFAYWVCNPSTGESRRLPQQRRHGQGLSSAGLAYDDQTKEHKVVHLFCHGDD
LRPRCEVYTLCSPSRQWRPVSLPVPRSLADAMACALMFEAAVTKVPPVFANGFLHWQIYP
NMDMDYRGLFPESIAYPYYTAAVLCFSVASETFDLVAGPAVDDMYRGLELDDSSPAVPLH
LVELQGSLCMVRDLRHLPHGEESLMMDIWALRDYRTSTWSLVHRIAMTPHVASGVHSPRF
VTVLGYLGGDGEMMSCEKKILIATSQHRVYAYDPATGDAETVLTNVLGLQEEAVAGLRLG
LYEDSLARTGGESRRQMEVASALTEILVRLPVRSIAQCMLVCKQWHAVIESESFVMSHLL
VSRQRRKVVMVTSGRARENFFGFMPMETWLGHPDPAARLLDSPLVVCSKPCHGLNLISTS
SDDYLCNPCTGSIRCLGIRGKFRNNNNPQDNKVGPPDHQRRHAFTVGSGRNVGLGFDRLT
REHVVVEISHLDGALVCMVKTDCAEYWTRVGDPPMPVTDMPPAHVDGTLYWMSEPELEAA
AGDRFVVAFDISARVFTVFPCQPCNGRSISNPFVVELEGVLSVVVADAEENTLRIWMMRE
HGASWANSYNVCLDKHPDFSLGTDNVVVVPMEIAGKDDGKKILLNTGRALGYYETRTRAI
DALYSLDQLLAFPMLYEESLAGIQDDEQPDHVAPPLWDDQGRPKEQPGYSIFRSCERSGC
HGPAATYASCCRRALCRECLAQCRDHSDWTFVDFAPGTPRTVMGIQEDLQLPVEHPSVPG
PEYCYCYSERDEDEDDVGRHVFVALKDHVRFRQPWRLIECGYRTDGEVVRETAQRLHGLR
PRYVADQF
Download sequence
Identical sequences K3Y4Y3
Si009271m|PACid:19693820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]