SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si009708m|PACid:19697653 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si009708m|PACid:19697653
Domain Number 1 Region: 77-146
Classification Level Classification E-value
Superfamily F-box domain 0.000000000746
Family F-box domain 0.0067
Further Details:      
 
Domain Number 2 Region: 253-464
Classification Level Classification E-value
Superfamily RNI-like 0.00000000863
Family 28-residue LRR 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si009708m|PACid:19697653
Sequence length 572
Sequence
MSIPTALFKRRCGRGREPGASARYAVRRAGGGTSLMVRRGRPGRFLPQRRPLAACSSLMA
RRCGRSGAGQILLRRRREDRISALPDDLLLLILRRLDTRSALGAGSLSKRWAHLPRELDA
LDLRASDMLPPRYHRWVDLYKDNRAFLHCFRAMNLELLANIRRYERRAMRAFISSTERFL
EGPRRRVKTLSLEFFITGNAGRMDRLVAEAIDAWGVEDLEAVAKRIFGSRGPGVDDFPIH
TFPSHGLCKEPRASRLRSLKLSGCVPPPLHEYNALNRLVLQGLPAPTPVAAYEDIFTLCP
QLQTLHLISCGCSTRKGISLIVTVDAPRSQIRELVVENCTFRKLSLRALPCLESLVSLQS
WVIFESSSFPCLSQRNLAVCLGLEEIDWRLDLELDMFLDCTPGIRNLIIRFTGPYRWIVP
SSPPSEFLPNLRRLLVADVPSSWDVTWPRLLLEMAPSLEILHIHIVHAVSKKPGEEIPWT
PTELRQHHLKEFVVVGFKGTARQICLVKFVVGVCTALCHLAMFKNGHVRYRGHWDWEMVT
QEQSWSDEEKGTTLKQIMDMVSSTSPVQLVLG
Download sequence
Identical sequences K3Y667
Si009708m|PACid:19697653 XP_004977207.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]