SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si009762m|PACid:19695961 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si009762m|PACid:19695961
Domain Number 1 Region: 116-463
Classification Level Classification E-value
Superfamily RNI-like 3.92e-33
Family 28-residue LRR 0.012
Further Details:      
 
Domain Number 2 Region: 46-91
Classification Level Classification E-value
Superfamily F-box domain 0.000000824
Family F-box domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si009762m|PACid:19695961
Sequence length 544
Sequence
MGLSPSSLSKSSPSSPPRRSRSLSPMAPPLLRTTAPAQVAAGGSGSSSSSFPPPARDYTQ
DLPDEILALVFASLLPAERSACSLACARWKEVDAATRHRLSLDARAGLGHAAPALFGRFT
AVTKLALRSARGSGADSLADEGAAAVADALPTDRLARLKLRGLRQLSDTGLASLAGAAPA
LRKLSVASCAFGPKAFVAVLQACPLLEDLSVKRLRGLPDTAGAATAITEEIKFPQALSLR
SVCLKDLYSAPSFVPLVASSPNLRSLKILRCTGAWDLPLEVITARAPGLVELHLEKLQVG
DRGLAALSACRNLEVLFLVKTPECTDLGIISVAERCHKLRKLHIDGWRTNRIGDFGLMAV
ARGCPDLQELVLIGVNPTVLSLRMLGEHCRALERLALCGCETVGDAEIICLAERCAALKK
LCIKGCPVSDRGMEALNGGCPSLVKVKLKRCRGVSYECIENLKVTRGESFSISLDIVLDH
DAGSASENGVQETGQAQITELADQMAGMDLPTNSVGAQSSTHTINRVSRVMSAIRRRFGN
PPPQ
Download sequence
Identical sequences K3Y6C1
Si009762m|PACid:19695961 XP_004976156.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]