SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si009835m|PACid:19696658 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si009835m|PACid:19696658
Domain Number 1 Region: 199-287,324-451
Classification Level Classification E-value
Superfamily L domain-like 0.00000000567
Family Ngr ectodomain-like 0.054
Further Details:      
 
Domain Number 2 Region: 54-117
Classification Level Classification E-value
Superfamily F-box domain 0.00000000641
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si009835m|PACid:19696658
Sequence length 521
Sequence
MRLERQQDQEYRRRFMSMLRQQGQERRRRAQTQTRDGSIASRGKRKGSPCQRDDGSQVAD
LDEIPSLPEHIWQHIHSLMPMRDAARAACVSRSFLYSWRSHPNLNFSKDTFGLIENACQK
DESGRFFYIKVDHILKKHSGIGVKKLKLQIDSDYSAKDSRYLNKWLQKAVTPGIEELTLI
FAPFGANYNFPCSLLLNGSGDSIRCLHLGCCSFRPKVTLGFRSLIRLHLCFVRTTGDALG
FVLSHSLALERLELRCCYGIVYLKVPRLLQHLNYLEVSGCIDLRVIDNEAPNISSFSYGG
YSAVQLSLGKTLQMEGSVSYARTEPPSSMPNLEALALNSQTERAHAPMLQSKFLRLRHLS
IALTAANYDYLSLVSFFDAAPSLETFDLNVLQLYMKNVSVFEDPADLRHMQGLQHHNLRS
VKITGFSSAKSLIELTCHVLRSVMSLECLTLEAPQSGFRCSHPYNKSGKCSSLDRYLVME
GHRGVMAIRRYIEPMVPSTVKLHVLEPCSCHAVELQMSCLS
Download sequence
Identical sequences K3Y6J4
Si009835m|PACid:19696658 XP_004977597.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]