SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si009924m|PACid:19696761 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si009924m|PACid:19696761
Domain Number 1 Region: 161-379
Classification Level Classification E-value
Superfamily RNI-like 0.00000000133
Family Rna1p (RanGAP1), N-terminal domain 0.054
Further Details:      
 
Domain Number 2 Region: 26-65
Classification Level Classification E-value
Superfamily F-box domain 0.000000654
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si009924m|PACid:19696761
Sequence length 499
Sequence
MPKKKDLLCQEDDRSEGGKISRYSGSGLPEDIWCHIHSLMPLRDAAHSACVSRTFLRSWR
CHPNLNFTKETLCVKRNACGKGGVARCFTMRVDQILKNHSGIGVKTLILDIPDSCKIDIC
RLNHWLQIAIAPGIEEVTIFLHSNYKTKYSFPCSLLFGGCGNSIRHLRLTNCAFRPPVGF
DCLRSLTKVHLYEVCITGDELGNLFSNSFALEHLELISCSDLISLKIPFWLERLSFLRVF
ECNMLQVIESKAPNLHTFKFFGNPGHLTLGESSQVKSLDFRLSNNFNSITYAITKLPSTV
PTLETLKLTSFSERVNTPMAADKFLNLKCLQIYLAGYEAFSPSYDYLSLVSFLDASPALE
TFILSVNQDVMKHDSVFGNASPMRQILGHKHDRLRKVQINGFCSAKSMVELTCHILENAT
SLESLTVDTIFAGFIGDDVRRCFLQKKSKCRSIPRDMILEAHNALRAVSSFIVGRVPPAI
KLNVWEPCSRCHAIDVKLP
Download sequence
Identical sequences K3Y6T3
XP_004977043.1.39314 XP_012702684.1.39314 XP_012702685.1.39314 XP_012702686.1.39314 Si009924m|PACid:19696761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]