SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si009953m|PACid:19694466 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si009953m|PACid:19694466
Domain Number 1 Region: 104-166
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000275
Family F-box domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si009953m|PACid:19694466
Sequence length 491
Sequence
MAVAGRERRFEGLAWSLVGEIIRGGRGGSRSGGGGGLWVAKPGVDGTGGGGRVTAVVREG
RGTATGGDGHFPHTYGKTSFQHDDDPRRPRKRHRVTPTPPATAATIPEDLLVSEILALLP
AESLLRSGSVVCRSWRAAVRDPAFIRRHLELSRARPPTMLAISWPMDEKEEDDDEEEATT
VTPPRVRALQRPGRRHRVDGPYGAHHPTMESVAVPTESPNVGPFTMITSAVAAIGFDPRT
NGYVLSRFFYRVNRIFTDGRSGSVVVEYDDVGHEVLRLGAGAGAGWRFTENAPFPIDDSV
PPVCVRGAIYWAAMDPSASGEDDVDDDGIANILLRFSLRDETFAVFPLPPRVRSVGRRNR
VAELAGELCHAHATAPTAFDVWVATGDDEPGRPAWWLRWHVDFYRPVDFVAPLAVDAGGV
LLMSVDEEDMYRYDKRNRVLEKVADVQQVSRPVRWNGSGGRGEDDVIPSCAAAELLVPCV
ENLVSITSCNN
Download sequence
Identical sequences K3Y6W2
Si009953m|PACid:19694466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]