SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si010012m|PACid:19694126 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si010012m|PACid:19694126
Domain Number 1 Region: 145-235,317-346
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000654
Family Cyclin A/CDK2-associated p19, Skp2 0.053
Further Details:      
 
Domain Number 2 Region: 11-54
Classification Level Classification E-value
Superfamily F-box domain 0.0000000641
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si010012m|PACid:19694126
Sequence length 473
Sequence
MAAPPRRDAVGEDLISNLPLELRSAIISRLATAEAARTAVLSTRWRDTWRGTPLRLDDLD
LPASPGLSIALATAAAGTPWAARADAVAVALASHPGPVERFRLARTTLRARVPTAEAWFR
DLAAGDHRAREVSLFCPPEWCHCALADPLLTSPTLETLALGECRFSDAGAAAASASRLTE
LSLSRTHISEAALQSLLSGCPALRSVMLKHIQGPRRIHISSCRNLVLLGVWQYKLLEELT
VEDAPRLERLLGDAHLGTEITIVGAPKLTALGYLVVGYRDFFHGIEMPTAQKKVAKGLRA
PFNSVKVLAIGVMLSSKKNLESVMNLLKCFPFLETLHIQGNKRAEGEFHTIDSNYYQKLD
PVGCMVNHLKSVRLEINIENQRSKVENPNILEFVCFLLANAQVLQIMKIQSSMFNNPAWI
TEKQNLLSQCHRASVEAKVVLEGLKVVHRKGFSIEDVNALPDPFDSDIDIMGY
Download sequence
Identical sequences K3Y721
XP_004975544.1.39314 Si010012m|PACid:19694126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]