SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si010068m|PACid:19694174 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si010068m|PACid:19694174
Domain Number 1 Region: 195-232
Classification Level Classification E-value
Superfamily F-box domain 0.000000474
Family F-box domain 0.0079
Further Details:      
 
Weak hits

Sequence:  Si010068m|PACid:19694174
Domain Number - Region: 239-290
Classification Level Classification E-value
Superfamily RNI-like 0.000188
Family 28-residue LRR 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si010068m|PACid:19694174
Sequence length 455
Sequence
MALNCSSRSPLLATDDCAGMMLGCGCRSEEASPLSSCGVNSLWWDDLELELEEEVDESDP
VDLLPTDPFGMNLETSFTAAIASCIEDLTVMSGAGHFGNGGDDDLFADLSYHYFNQAFVF
APEPCIGGYMGVFEGSFGFGGLSGGGGMDQFSRLPFEPAGSMEDPSSSCEATLACCDTVD
AAPVQEGNDAHEGMVFVLGYLGLRDILSLEMVCKSLRSAIRNEPFLWKCIHIDSQLGEKI
SDADLLCLTQKSLGSLQCLSLEGCTEISDQGLKAILESNLQLTKLGIFGAFRMTYQGLID
NLRSFNMVADIGIKKLRVANRFTLSEAQYEELLSLLRIDNGQALHKQEPRIFHPDSLLPD
PQGGYVPDGFMPDLHDEYALDIEKCPLCPNYKLVFDCPSEECKISGSVTCRGCAVCIKRC
IKCGRCIDDEFHETFLLESICPICQPHGDSSPSEK
Download sequence
Identical sequences K3Y775
XP_004976013.1.39314 Si010066m|PACid:19694175 Si010068m|PACid:19694174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]