SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si010351m|PACid:19695689 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si010351m|PACid:19695689
Domain Number 1 Region: 15-79
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000034
Family F-box domain 0.0081
Further Details:      
 
Weak hits

Sequence:  Si010351m|PACid:19695689
Domain Number - Region: 256-359
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0222
Family Putative isomerase YbhE 0.029
Further Details:      
 
Domain Number - Region: 194-243
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0856
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si010351m|PACid:19695689
Sequence length 379
Sequence
MAEQPREKTANTAAASLTDDLIVDILSRLPVKSLCRCKCVSPHWRDLISHPDHRRRLPQT
LAGFFRDDFNDGREVWRFTNLCEARQPPLISTPFAFMPGYEDAAIVDACNGLLLCRPPKG
SPHHLSRYVVCNPATKSWVVLPDSGSHGDDVEDDEPFVARLGFDPAVSVHFHVFEFVENT
YGTVAGVEIYSSEVGAWSYKESQWNYETHLFEFSPSVFLNGLLHFSTIQFEVVAVDVVGE
SWWVLPAPEDPDDVDDRANWDPGFLGRYQGHLCYMTLCYNVRDLSIWVLEDYGEDGWVLK
RQVTVRQLTEKISPPESYYYHLITVHPDCNWILYVTGLESMLMAYDMDHDEVHVIQNLRS
VMSCIPYVPLYAKSLTDGN
Download sequence
Identical sequences K3Y810
Si010351m|PACid:19695689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]