SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si010370m|PACid:19695898 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si010370m|PACid:19695898
Domain Number 1 Region: 7-80
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000654
Family F-box domain 0.0083
Further Details:      
 
Weak hits

Sequence:  Si010370m|PACid:19695898
Domain Number - Region: 125-355
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00275
Family Galactose oxidase, central domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si010370m|PACid:19695898
Sequence length 375
Sequence
MANPAAASLTDDLIVEILSRLPVKSLCRCKCVSPHWRGLISHPDHRHRLPQTLAGFFLNA
SNRGRQARRFINLSEASRPPLIRYPFSFMPGYEDVTIVDSCNGLLLCRASRTESSSPDAV
FCHVVCNPATRSWHVLPNSSSGCVDNNNELRPARLGFDPAVSPNFHVFEFVHSEQGYGCV
AGVEIYSSETGAWSYSESEWEEETHLLEGSPSVFFDGLLHFITIDFTVVAVNVKGESWWE
KAVPEDSYDLQNWDFCEAWEPCFIGRYKGNLCYINEFYSDTDVSIWVLEDYAADEWILKH
RVSIQRLTKNIATPAESKCYNFITVHPHCNWFLYVTGSDKILMAYDMDRDEVHVIQNLGL
DCILQCIPYVPFYGN
Download sequence
Identical sequences K3Y829
XP_004975263.1.39314 XP_012703055.1.39314 Si010370m|PACid:19695898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]