SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si010439m|PACid:19694192 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si010439m|PACid:19694192
Domain Number 1 Region: 11-85
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000196
Family F-box domain 0.0071
Further Details:      
 
Weak hits

Sequence:  Si010439m|PACid:19694192
Domain Number - Region: 197-336
Classification Level Classification E-value
Superfamily YWTD domain 0.000157
Family YWTD domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si010439m|PACid:19694192
Sequence length 359
Sequence
MMEKGSPNQAAAGLPDDLIVEILARLPAGPLCRCKCVSQSWRALISDPAHRARFAHTLSG
FFVFSRPHSASAPSSWSFIAIQQSPPLVDTALSFLPPSHGEIDILDSRNGLLLLRCPGEG
DRHPCYVVCNPATAEWVALPQPSQTPGQQCDRDGRGLKTTSAALGFNPAVSSCFYVFQLM
EEKWVYNNVNVIRAVEIYSSETGAWISRLSGWKDRLVFFAGNKTYFKVQDRAYITCVFVG
HSQGRLRYVHEDDEQPGDSLSICVLEGNVNEEFTVKHSVRKMDLFGPRKSRWPKEHQTVA
FHPDGNLIFLYHRPSDRLMCYDMNRREMHVICDVGGVKPCQHLFLPYVPYYSRVLVSPN
Download sequence
Identical sequences K3Y898
Si010439m|PACid:19694192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]