SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si010593m|PACid:19697674 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si010593m|PACid:19697674
Domain Number 1 Region: 57-137
Classification Level Classification E-value
Superfamily F-box domain 1.85e-18
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si010593m|PACid:19697674
Sequence length 326
Sequence
MASDISVDIRPDFNSFDHFLSMRYVATDRPWMKLYGIRVQPVLPFRSLSCKPDPALIHQC
LPDELLLEIFTRMNPYTLGRAACVCRKWKYTARNPTLWRAACLKTWQRSGMEANYMMVRS
LYDSSWRRMWLQRPRIRIDGLYVSRNTYIHTGVTEWQFKKTVNVVCYYRYLRFFPSGKFL
YKISPDKVKDAVKCMHFRASKADCVFKGDYVLSEDGQIEMALLYPGHRYTLVRMCLRLRG
TKIGANNRLDVLKILTTGVNATELKNWTGSILELVEGWEEDETHDPDVPAVSHSRGLSPF
VFVPFEEADTSVLNLPVEKMDYYVPG
Download sequence
Identical sequences K3Y8Q1
Si010593m|PACid:19697674 XP_012703345.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]