SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011232m|PACid:19697549 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011232m|PACid:19697549
Domain Number 1 Region: 57-91
Classification Level Classification E-value
Superfamily F-box domain 0.000000392
Family F-box domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si011232m|PACid:19697549
Sequence length 154
Sequence
MTPTKKTAAPPMGDLFSRPQAARYIAEWLAGLSLLRRKMLRRRESMTPQGPAAAASNEAL
ANVFQRLPPKCAAACRGVCLRWSVLLSSPRLAALADADVDAAGSSTCFAGRDGVCGAGQI
ERRRRRGGAVFWLPPLPKHQYRRSRKKHVYRGMF
Download sequence
Identical sequences K3YAJ0
Si011232m|PACid:19697549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]