SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si011705m|PACid:19696108 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si011705m|PACid:19696108
Domain Number 1 Region: 230-386
Classification Level Classification E-value
Superfamily RNI-like 0.000000000051
Family Rna1p (RanGAP1), N-terminal domain 0.096
Further Details:      
 
Weak hits

Sequence:  Si011705m|PACid:19696108
Domain Number - Region: 155-204
Classification Level Classification E-value
Superfamily F-box domain 0.00017
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si011705m|PACid:19696108
Sequence length 419
Sequence
MKRRNQKLWGRLGGGGGQGWKAKRARPDCGWRGGAEPVVRWSHAEAMKKSPAGGGDAVVA
GGSGGWARGVLGPGKAGLGGPSCGSGGFWTSWSEAAAPAKAAGTATCGGKGVQMWDWTEP
DAEKARPWGAGVGEAGGAEEDVVYEWRWTEAVSPEILALVLRGRVAADEVARGVALVCRA
WRQAAASPDMWGDVDIEAWCRRVNCRARADAAVRRLVTRAQGTLRRLSAYRVGDASLAYV
AASGRLLNVLQIPMSEITDQTVEKHAECLPALKVLDISNCLNITSRGIEALGRHCKLLIQ
LKRNMPPPDPPLGNNTAAKVVEEEALAVANTMPVLEQLELAYGLFSDLALNAILNKCPLL
RVLDILGCWNVRLDGDIEDRCCALESFREPWEPEYSTDSSSGGDYDDNNTDSDDSQGSV
Download sequence
Identical sequences K3YBW1
Si011705m|PACid:19696108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]